IL18 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A20473-20UL
100 ul
£336,00
A20473-100UL
500 ul
£1258,00
A20473-500UL
1000 ul
£2228,00
A20473-1000UL
Über dieses Produkt
- SKU:
- A20473
- Zusätzliche Namen:
- Igif|Il-18|IL18
- Anwendung:
- ELISA, IHC-Paraffin, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Enables cytokine activity. Involved in lipid homeostasis; positive regulation of cell differentiation; and positive regulation of cold-induced thermogenesis. Acts upstream of or within several processes, including interleukin-18-mediated signaling pathway; positive regulation of NIK/NF-kappaB signaling; and positive regulation of interferon-gamma production. Located in extracellular space. Is expressed in several structures, including back skin; dorsal aorta; gut; lymphatic system; and reproductive system. Used to study atopic dermatitis. Human ortholog(s) of this gene implicated in several diseases, including Kawasaki disease; allergic rhinitis; autoimmune disease (multiple); biliary atresia; and hepatitis B. Orthologous to human IL18 (interleukin 18).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 22kDa/18kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- NFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A20473