Rev-erb beta/NR1D2 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A20447-20UL
100 ul
£336,00
A20447-100UL
500 ul
£1258,00
A20447-500UL
1000 ul
£2228,00
A20447-1000UL
Über dieses Produkt
- SKU:
- A20447
- Zusätzliche Namen:
- BD73|EAR-1R|Rev-erb beta/NR1D2|REVERBB|REVERBbeta|RVR
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- This gene encodes a member of the nuclear hormone receptor family, specifically the NR1 subfamily of receptors. The encoded protein functions as a transcriptional repressor and may play a role in circadian rhythms and carbohydrate and lipid metabolism. Alternatively spliced transcript variants have been described.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 70kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse, Rat
- Sequenz:
- ALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQPQRGERIPKNMEQYNLNHDH
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A20447