TriMethyl-Histone H3-K36 Rabbit monoclonal antibody
Produktgrößen
5 ul
£ POA
A20379-5UL
20 ul
£164,00
A20379-20UL
100 ul
£342,00
A20379-100UL
500 ul
£1532,00
A20379-500UL
1000 ul
£2704,00
A20379-1000UL
Über dieses Produkt
- SKU:
- A20379
- Zusätzliche Namen:
- H3.4|H3/g|H3FT|H3t|HIST1H3A|HIST3H3|Histone H3|TriMethyl-Histone H3-K36
- Anwendung:
- ChIP, Dot Blot, ELISA, IHC-Paraffin, Immunoprecipitation, Western Blot
- Klonalität:
- Monoclonal
- Weitere Details:
- Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3.
- Formulierung:
- TriMethyl K36
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 17kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Other Species, Rat
- Sequenz:
- MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A20379