Slc39a11 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A20338-20UL
100 ul
£336,00
A20338-100UL
500 ul
£1258,00
A20338-500UL
1000 ul
£2228,00
A20338-1000UL
Über dieses Produkt
- SKU:
- A20338
- Zusätzliche Namen:
- 1810074D23Rik|Slc39a11|ZIP-11
- Anwendung:
- ELISA, IHC-Paraffin, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Enables zinc ion transmembrane transporter activity. Predicted to be involved in zinc ion transmembrane transport. Predicted to act upstream of or within zinc ion transport. Located in Golgi apparatus; nucleus; and plasma membrane. Orthologous to human SLC39A11 (solute carrier family 39 member 11).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 35kda
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- HLGATEDPQTALALNLDPALMKKSDPRDPTSLLFPESELSIRIGSTGLLSDKRENGEVYQRKKVAATDLAEGVA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A20338