SARS-CoV-2 ORF9b Rabbit polyclonal antibody
Produktgrößen
5 ul
£ POA
A20260-5UL
20 ul
£152,00
A20260-20UL
100 ul
£336,00
A20260-100UL
500 ul
£1258,00
A20260-500UL
1000 ul
£2228,00
A20260-1000UL
Über dieses Produkt
- SKU:
- A20260
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- SARS-CoV-2 (severe acute respiratory syndrome coronavirus 2) is the causative agent of the COVID19 pandemic.?? SARS-CoV-2 and SARS-CoVshare many proteins common in other CoVs, including 4 majorstructural proteins (S, E, M, and N proteins) and 16 nonstructuralproteins (nsp1-16), they possess a unique set of proteins, namelyorf3a, 3b, 6, 7a, 7b, 8a, 8b, and 9b.The SARS-CoV-2 genome encodes for a small accessory protein termed Orf9b,?? which targets the mitochondrial outer membrane protein TOM70 in infected cells.This 98-amino acid (aa) protein is encoded by analternative open reading frame (ORF) within the N gene and istranslated via a leaky scanning mechanism during translationCrystal structures of orf9b alone revealed a homodimericB Beta-strand-rich structure? with a hydro_x005fphobic central tunnel for lipid binding, consistent with the role oforf9b in the mature virion assembly
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 12-14kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Virus
- Sequenz:
- MDPKISEMHPALRLVDPQIQLAVTRMENAVGRDQNNVGPKVYPIILRLGSPLSLNMARKTLNSLEDKAFQLTPIAVQMTKLATTEELPDEFVVVTVK
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A20260