Btbd11 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A20192-20UL
100 ul
£336,00
A20192-100UL
500 ul
£1258,00
A20192-500UL
1000 ul
£2228,00
A20192-1000UL
Über dieses Produkt
- SKU:
- A20192
- Zusätzliche Namen:
- 6330404E16Rik|Btbd11
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Predicted to enable protein heterodimerization activity. Acts upstream of or within SMAD protein signal transduction. Predicted to be located in membrane. Predicted to be integral component of membrane. Is expressed in central nervous system; dorsal root ganglion; genitourinary system; and thymus primordium. Orthologous to human BTBD11 (BTB domain containing 11).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 121kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- MARRGKKPVVRTLEDLTLDSGYGGAADSVRSSNLSLCCSDSHPASPYGGSCWPPLADSMHSRHNSFDTVNTALVEDSEGLDCAGQHCSRLLPDLDEVPWTLQELELLLLRSRDPRAGPAV
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A20192