Stella Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A20176-20UL
100 ul
£336,00
A20176-100UL
500 ul
£1258,00
A20176-500UL
1000 ul
£2228,00
A20176-1000UL
Über dieses Produkt
- SKU:
- A20176
- Zusätzliche Namen:
- 2410075G02Rik|PCG7|PGC7|Stella
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Enables methylated histone binding activity. Involved in negative regulation of DNA demethylation; protection of DNA demethylation of female pronucleus; and regulation of genetic imprinting. Acts upstream of or within embryonic cleavage. Located in cytoplasm; female pronucleus; and male pronucleus. Is expressed in several structures, including central nervous system; early conceptus; gonad; hindgut diverticulum; and primordial germ cell. Orthologous to human DPPA3 (developmental pluripotency associated 3).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 17kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse, Rat
- Sequenz:
- MEEPSEKVDPMKDPETPQKKDEEDALDDTDVLQPETLVKVMKKLTLNPGVKRSARRRSLRNRIAAVPVENKSEKIRREVQSAFPKRRVRTLLSVLKDPIAKMRRLVRIEQRQKRLEGNEFERDSEPFRCLCTFCHYQRWDPSENAKIGKN
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A20176