STING/TMEM173 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A20175-20UL
100 ul
£336,00
A20175-100UL
500 ul
£1258,00
A20175-500UL
1000 ul
£2228,00
A20175-1000UL
Über dieses Produkt
- SKU:
- A20175
- Zusätzliche Namen:
- 2610307O08Rik|ERIS|Mita|MPYS|STING|STING-beta|Tmem173
- Anwendung:
- ELISA, IHC-Paraffin, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Enables 2',3'-cyclic GMP-AMP binding activity; cyclic-di-GMP binding activity; and ubiquitin protein ligase binding activity. Involved in several processes, including defense response to other organism; macroautophagy; and positive regulation of interferon-beta production. Acts upstream of or within cellular response to interferon-beta; positive regulation of transcription by RNA polymerase II; and regulation of inflammatory response. Located in several cellular components, including autophagosome; perinuclear region of cytoplasm; and peroxisome. Is expressed in ductus deferens; epididymis; ileum; and prostate gland. Human ortholog(s) of this gene implicated in STING-associated vasculopathy with onset in infancy. Orthologous to human STING1 (stimulator of interferon response cGAMP interactor 1).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 33 kDa/35 kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- SREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKP
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A20175