Tubulin beta-1 chain Rabbit monoclonal antibody
Produktgrößen
5 ul
£ POA
A19805-5UL
20 ul
£164,00
A19805-20UL
100 ul
£342,00
A19805-100UL
500 ul
£1532,00
A19805-500UL
1000 ul
£2704,00
A19805-1000UL
Über dieses Produkt
- SKU:
- A19805
- Zusätzliche Namen:
- MACTHC1|Tubulin beta-1 chain
- Anwendung:
- ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
- Klonalität:
- Monoclonal
- Weitere Details:
- This gene encodes a member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is specifically expressed in platelets and megakaryocytes and may be involved in proplatelet production and platelet release. A mutations in this gene is associated with autosomal dominant macrothrombocytopenia. Two pseudogenes of this gene are found on chromosome Y.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 55 kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Bovine, Canine, Human, Mouse, Non-human Primate, Rat
- Sequenz:
- AVCDIPPRGLSMAATFIGNNTAIQEIFNRVSEHFSAMFKRKAFVHWYTSEGMDINEFGEAENNIHDLVSEYQQFQDAKAVLEEDEEVTEEAEMEPEDKGH
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A19805