Integrin alpha V (ITGAV/CD51) Rabbit monoclonal antibody
Produktgrößen
5 ul
£ POA
A19071-5UL
20 ul
£164,00
A19071-20UL
100 ul
£342,00
A19071-100UL
500 ul
£1532,00
A19071-500UL
1000 ul
£2704,00
A19071-1000UL
Über dieses Produkt
- SKU:
- A19071
- Zusätzliche Namen:
- CD51|Integrin alpha V (ITGAV/CD51)|MSK8|VNRA|VTNR
- Anwendung:
- ELISA, Flow Cytometry, IHC-Paraffin, Western Blot
- Klonalität:
- Monoclonal
- Weitere Details:
- The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha V subunit. This subunit associates with beta 1, beta 3, beta 5, beta 6 and beta 8 subunits. The heterodimer consisting of alpha V and beta 3 subunits is also known as the vitronectin receptor. This integrin may regulate angiogenesis and cancer progression. Alternative splicing results in multiple transcript variants. Note that the integrin alpha 5 and integrin alpha V subunits are encoded by distinct genes.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 140kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- SLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A19071