HNF3B Beta/FOXA2 Rabbit monoclonal antibody
Produktgrößen
5 ul
£ POA
A19053-5UL
20 ul
£164,00
A19053-20UL
100 ul
£342,00
A19053-100UL
500 ul
£1532,00
A19053-500UL
1000 ul
£2704,00
A19053-1000UL
Über dieses Produkt
- SKU:
- A19053
- Zusätzliche Namen:
- HNF-3-beta|HNF3B|HNF3B Beta/FOXA2|TCF3B
- Anwendung:
- ELISA, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Western Blot
- Klonalität:
- Monoclonal
- Weitere Details:
- This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific genes such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Transcript variants encoding different isoforms have been identified for this gene.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 55kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Sequenz:
- MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGSGSGNMSAGSMNMSSYVGAGMSPSLAGMSPGAGAMAGMGGSAGAAGVA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A19053