[KO Validated] c-Myc Rabbit monoclonal antibody
Produktgrößen
5 ul
£ POA
A19032-5UL
20 ul
£164,00
A19032-20UL
100 ul
£342,00
A19032-100UL
500 ul
£1532,00
A19032-500UL
1000 ul
£2704,00
A19032-1000UL
Über dieses Produkt
- SKU:
- A19032
- Zusätzliche Namen:
- bHLHe39|c-Myc|MRTL|MYCC|yc
- Anwendung:
- Cell-based/Functional Assay, ChIP, ELISA, Western Blot
- Klonalität:
- Monoclonal
- Weitere Details:
- This gene is a proto-oncogene and encodes a nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. The encoded protein forms a heterodimer with the related transcription factor MAX. This complex binds to the E box DNA consensus sequence and regulates the transcription of specific target genes. Amplification of this gene is frequently observed in numerous human cancers. Translocations involving this gene are associated with Burkitt lymphoma and multiple myeloma in human patients. There is evidence to show that translation initiates both from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site, resulting in the production of two isoforms with distinct N-termini.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 50-60 kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Sequenz:
- MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A19032