CXCL9 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A1864-20UL
100 ul
£336,00
A1864-100UL
500 ul
£1258,00
A1864-500UL
1000 ul
£2228,00
A1864-1000UL
Über dieses Produkt
- SKU:
- A1864
- Zusätzliche Namen:
- CMK|crg-10|CXCL9|Humig|MIG|SCYB9
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded is thought to be involved in T cell trafficking. The encoded protein binds to C-X-C motif chemokine 3 and is a chemoattractant for lymphocytes but not for neutrophils.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 14 kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Rat
- Sequenz:
- KQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A1864