CELF5 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A18482-20UL
100 ul
£336,00
A18482-100UL
500 ul
£1258,00
A18482-500UL
1000 ul
£2228,00
A18482-1000UL
Über dieses Produkt
- SKU:
- A18482
- Zusätzliche Namen:
- BRUNOL-5|BRUNOL5|CELF-5|CELF5
- Anwendung:
- ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- This gene encodes a member of the the CELF/BRUNOL protein family, which contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing and translation. Alternatively spliced transcript variants have been found for this gene.
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 52kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse
- Sequenz:
- MARLTESEARRQQQQLLQPRPSPVGSSGPEPPGGQPDGMKDLDAI
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A18482