Histone H2B Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A18305-20UL
100 ul
£336,00
A18305-100UL
500 ul
£1258,00
A18305-500UL
1000 ul
£2228,00
A18305-1000UL
Über dieses Produkt
- SKU:
- A18305
- Zusätzliche Namen:
- GL105|H2B|H2B-GL105|H2B.1|H2BE|H2BFQ|H2BGL105|H2BQ|HIST2H2BE|Histone H2B
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a replication-dependent histone that is a member of the histone H2B family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif. The protein has antibacterial and antifungal antimicrobial activity.
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 14kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Other Species, Rat
- Sequenz:
- MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVR
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A18305