MOB1A/MOB1B Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A18246-20UL
100 ul
£336,00
A18246-100UL
500 ul
£1258,00
A18246-500UL
1000 ul
£2228,00
A18246-1000UL
Über dieses Produkt
- SKU:
- A18246
- Zusätzliche Namen:
- MOB1A/MOB1B
- Anwendung:
- ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- The protein MOB1 is considered to be one of the core components of the mammalian Hippo signaling pathway, which controls organ size and tumor growth by enhancing apoptosis. Loss of the encoded protein results in cell proliferation and cancer formation. The encoded protein is also involved in the control of microtubule stability during cytokinesis. MOB1A and MOB1B, which have 95% sequence identity, play redundant biological roles and are both termed MOB1.
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 24kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- TILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR/MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A18246