VWC2L Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A17853-20UL
100 ul
£336,00
A17853-100UL
500 ul
£1258,00
A17853-500UL
1000 ul
£2228,00
A17853-1000UL
Über dieses Produkt
- SKU:
- A17853
- Zusätzliche Namen:
- A830006F12Rik|Brl|VWC2L
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Acts upstream of or within negative regulation of BMP signaling pathway and positive regulation of neuron differentiation. Located in extracellular space. Part of AMPA glutamate receptor complex. Is expressed in brain; central nervous system; hippocampus; hypothalamus; and thalamus. Orthologous to human VWC2L (von Willebrand factor C domain containing 2 like).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 23kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse
- Sequenz:
- MALHIHEACILLLVIPGLVTSAAISHEDYPADEGDQASSNDNLIFDDYRG
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A17853