SATB2 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A16721-20UL
100 ul
£336,00
A16721-100UL
500 ul
£1258,00
A16721-500UL
1000 ul
£2228,00
A16721-1000UL
Über dieses Produkt
- SKU:
- A16721
- Zusätzliche Namen:
- C2DELq32q33|DEL2Q32Q33|GLSS|SATB2
- Anwendung:
- ELISA, IHC-Paraffin, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- This gene encodes a DNA binding protein that specifically binds nuclear matrix attachment regions. The encoded protein is involved in transcription regulation and chromatin remodeling. Defects in this gene are associated with isolated cleft palate and cognitive disability. Alternate splicing results in multiple transcript variants that encode the same protein.
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 83kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Rat
- Sequenz:
- HDVGLYPDQEAIHTLSAQLDLPKHTIIKFFQNQRYHVKHHGKLKEHLGSAVDVAEYKDEELLTESEENDSEEGSEEMYKVEAEEENADKSKAAPAEIDQR
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A16721