Epn2 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A16623-20UL
100 ul
£336,00
A16623-100UL
500 ul
£1258,00
A16623-500UL
1000 ul
£2228,00
A16623-1000UL
Über dieses Produkt
- SKU:
- A16623
- Zusätzliche Namen:
- 9530051D10Rik|Epn2|Ibp2
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Predicted to enable clathrin binding activity and phospholipid binding activity. Acts upstream of or within Notch signaling pathway; embryonic organ development; and in utero embryonic development. Predicted to be located in intracellular membrane-bounded organelle. Predicted to be part of clathrin coat of endocytic vesicle. Predicted to be active in endosome and plasma membrane. Orthologous to human EPN2 (epsin 2).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 68kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- IFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERLKVERVQALKTKERMAQVATGVGSNQITFGRGSSQPNLSTSYSEQEYGKAGGSPASYHGSP
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A16623