Steroidogenic factor-1 (SF-1/NR5A1) Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A1657-20UL
100 ul
£336,00
A1657-100UL
500 ul
£1258,00
A1657-500UL
1000 ul
£2228,00
A1657-1000UL
Über dieses Produkt
- SKU:
- A1657
- Zusätzliche Namen:
- AD4BP|ELP|FTZ1|FTZF1|hSF-1|POF7|SF-1|SF1|SPGF8|SRXX4|SRXY3|Steroidogenic factor-1 (SF-1/NR5A1)
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- The protein encoded by this gene is a transcriptional activator involved in sex determination. The encoded protein binds DNA as a monomer. Defects in this gene are a cause of XY sex reversal with or without adrenal failure as well as adrenocortical insufficiency without ovarian defect.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 50kda
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- MDYSYDEDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKTQRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKAQIRANGFKL
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A1657