ZNF620 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A16197-20UL
100 ul
£336,00
A16197-100UL
500 ul
£1258,00
A16197-500UL
1000 ul
£2228,00
A16197-1000UL
Über dieses Produkt
- SKU:
- A16197
- Zusätzliche Namen:
- ZNF620
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Predicted to enable DNA-binding transcription repressor activity, RNA polymerase II-specific and RNA polymerase II transcription regulatory region sequence-specific DNA binding activity. Predicted to be involved in negative regulation of transcription by RNA polymerase II. Predicted to be located in nucleus.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- Refer to figures
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- MVGGLPGNVSQHLDFGSSLEQPQGHWIIKTKSKRRHFTDTSARHHEAYEVKNGEKFEKLGKNISVSTQLTTNQTNPSGQISYECGQCGRYFIQMADFHRHEKCHTGEKSFECKECGKYFRYNSLLIRHQIIHTGKKPFKCKECGKGLSSD
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A16197