RBM39 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A15760-20UL
100 ul
£336,00
A15760-100UL
500 ul
£1258,00
A15760-500UL
1000 ul
£2228,00
A15760-1000UL
Über dieses Produkt
- SKU:
- A15760
- Zusätzliche Namen:
- CAPER|CAPERalpha|FSAP59|HCC1|RBM39|RNPC2
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- This gene encodes a member of the U2AF65 family of proteins. The encoded protein is found in the nucleus, where it co-localizes with core spliceosomal proteins. It has been shown to play a role in both steroid hormone receptor-mediated transcription and alternative splicing, and it is also a transcriptional coregulator of the viral oncoprotein v-Rel. Multiple transcript variants have been observed for this gene. A related pseudogene has been identified on chromosome X.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 70 kda
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Sequenz:
- ATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A15760