EIF4ENIF1 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A15175-20UL
100 ul
£336,00
A15175-100UL
500 ul
£1258,00
A15175-500UL
1000 ul
£2228,00
A15175-1000UL
Über dieses Produkt
- SKU:
- A15175
- Zusätzliche Namen:
- 4E-T|Clast4|EIF4ENIF1
- Anwendung:
- ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- The protein encoded by this gene is a nucleocytoplasmic shuttle protein for the translation initiation factor eIF4E. This shuttle protein interacts with the importin alpha-beta complex to mediate nuclear import of eIF4E. It is predominantly cytoplasmic; its own nuclear import is regulated by a nuclear localization signal and nuclear export signals. Multiple transcript variants encoding different isoforms have been found for this gene.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 178kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- LGGRRIGSGRIISARTFEKDHRLSDKDLRDLRDRDRERDFKDKRFRREFGDSKRVFGERRRNDSYTEEEPEWFSAGPTSQSETIELTGFDDKILEEDHKGR
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A15175