KDM7A Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A14692-20UL
100 ul
£336,00
A14692-100UL
500 ul
£1258,00
A14692-500UL
1000 ul
£2228,00
A14692-1000UL
Über dieses Produkt
- SKU:
- A14692
- Zusätzliche Namen:
- A630082K20Rik|Jhdm1d|KDM7A|mKIAA1718
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Enables histone H3-methyl-lysine-9 demethylase activity and histone H3-tri/di-methyl-lysine-27 demethylase activity. Involved in histone H3-K27 demethylation; histone H3-K9 demethylation; and positive regulation of transcription, DNA-templated. Predicted to be located in nucleolus and nucleoplasm. Human ortholog(s) of this gene implicated in melanoma. Orthologous to human KDM7A (lysine demethylase 7A).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 106kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Sequenz:
- WHRHDYTEVDDGSKPVQAGTRAFVKELRSRVFPSADEIIVKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPAFSVMDVERYVGGDKVIDVIDVARQ
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A14692