IFIT3 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A14004-20UL
100 ul
£336,00
A14004-100UL
500 ul
£1258,00
A14004-500UL
1000 ul
£2228,00
A14004-1000UL
Über dieses Produkt
- SKU:
- A14004
- Zusätzliche Namen:
- Ifi49|IFIT3|P49
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Predicted to enable RNA binding activity and identical protein binding activity. Acts upstream of or within cellular response to interferon-beta; response to bacterium; and response to stilbenoid. Predicted to be located in mitochondrion. Predicted to be active in cytosol. Is expressed in alimentary system; eye; face; and nervous system. Orthologous to human IFIT3 (interferon induced protein with tetratricopeptide repeats 3).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 60kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- YAWIYYHMGRLSEAQAYVDKVRQVCQKFANPYSMECPELECEEGWTRLKCGRNERAKMCFEKALEEKPKDPECSSGMAIAMFRLEEKPEKQFSVDALKQAM
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A14004