LLGL2 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A13323-20UL
100 ul
£336,00
A13323-100UL
500 ul
£1258,00
A13323-500UL
1000 ul
£2228,00
A13323-1000UL
Über dieses Produkt
- SKU:
- A13323
- Zusätzliche Namen:
- 9130006H11Rik|LLGL2|Llglh2
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Predicted to enable GTPase activator activity; PDZ domain binding activity; and myosin II binding activity. Acts upstream of or within establishment or maintenance of polarity of embryonic epithelium; labyrinthine layer development; and post-embryonic development. Predicted to be located in cytosol and intracellular membrane-bounded organelle. Predicted to be active in cortical actin cytoskeleton and plasma membrane. Is expressed in several structures, including cardiovascular system; endocrine gland; genitourinary system; gut; and nasal cavity epithelium. Orthologous to human LLGL2 (LLGL scribble cell polarity complex component 2).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 114kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse, Rat
- Sequenz:
- DSTKAKKHNRPSNGNGTGLKMTSSGHVRNSKSQSDGDEKKPGPVMEHALLNDAWVLKEIQSTLEGDRRSYGNWHPHRVAVGCRLSNGEAE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A13323