Kdm6b Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A12763-20UL
100 ul
£336,00
A12763-100UL
500 ul
£1258,00
A12763-500UL
1000 ul
£2228,00
A12763-1000UL
Über dieses Produkt
- SKU:
- A12763
- Zusätzliche Namen:
- 1700064E03Rik|Jmjd3|Kdm6b
- Anwendung:
- ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Enables beta-catenin binding activity; histone H3-tri/di-methyl-lysine-27 demethylase activity; and sequence-specific DNA binding activity. Involved in several processes, including histone H3-K27 demethylation; mesodermal cell differentiation; and positive regulation of cold-induced thermogenesis. Acts upstream of or within several processes, including cellular response to hydrogen peroxide; histone demethylation; and positive regulation of transcription by RNA polymerase II. Located in nucleus. Is expressed in several structures, including brain; gut; liver; metanephros; and olfactory epithelium. Orthologous to human KDM6B (lysine demethylase 6B).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 170kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse
- Sequenz:
- LESLHGCVQALLREPAQPGLWEQLGQLYESEHDSEEAVCCYHRALRYGGSFAELGPRIGRLQQAQLWNFHAGSCQHRAKVLPPLEQVWNLLHLEHKRNYGA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A12763