RBP4 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A12495-20UL
100 ul
£336,00
A12495-100UL
500 ul
£1258,00
A12495-500UL
1000 ul
£2228,00
A12495-1000UL
Über dieses Produkt
- SKU:
- A12495
- Zusätzliche Namen:
- MCOPCB10|RBP4|RDCCAS
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 19kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A12495