APOH Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A1220-20UL
100 ul
£336,00
A1220-100UL
500 ul
£1258,00
A1220-500UL
1000 ul
£2228,00
A1220-1000UL
Über dieses Produkt
- SKU:
- A1220
- Zusätzliche Namen:
- APOH|B2G1|B2GP1|BG
- Anwendung:
- ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Apolipoprotein H, also known as beta-2-glycoprotein I, is a component of circulating plasma lipoproteins. It has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, hemostasis, and the production of antiphospholipid autoantibodies. APOH may be a required cofactor for anionic phospholipid binding by the antiphospholipid autoantibodies found in sera of many patients with lupus and primary antiphospholipid syndrome (APS). The anti-beta (2) glycoprotein I antibodies from APS patients, mediate inhibition of activated protein C which has anticoagulant properties. Because beta-2-GPI is the main autoantigen in patients with APS, the disruption of this pathway by autoantibodies may be an important mechanism for thrombosis in patients with APS.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 45kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse
- Sequenz:
- RTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A1220