SAA3 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A11948-20UL
100 ug
£336,00
A11948-100UG
500 ul
£1258,00
A11948-500UL
1000 ul
£2228,00
A11948-1000UL
Über dieses Produkt
- SKU:
- A11948
- Zusätzliche Namen:
- l7R3|Saa-3|SAA3
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Enables Toll-like receptor 4 binding activity and chemoattractant activity. Acts upstream of or within several processes, including I-kappaB phosphorylation; cellular response to interleukin-1; and response to stilbenoid. Located in extracellular space. Is expressed in cerebellum; ileum; liver; reproductive system; and thymus. Orthologous to several human genes including SAA2 (serum amyloid A2).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 14kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- SDKYFHARGNYDAARRGPGGAWAAKVISDAREAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPKRY
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A11948