Glucagon Rabbit monoclonal antibody
Produktgrößen
5 ul
£ POA
A11767-5UL
20 ul
£164,00
A11767-20UL
100 ul
£342,00
A11767-100UL
500 ul
£1532,00
A11767-500UL
1000 ul
£2704,00
A11767-1000UL
Über dieses Produkt
- SKU:
- A11767
- Zusätzliche Namen:
- GLP-1|GLP1|GLP2|Glucagon|GRPP
- Anwendung:
- ELISA, IHC-Paraffin, Immunofluorescence
- Klonalität:
- Monoclonal
- Weitere Details:
- The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- Refer to figures
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse, Rat
- Sequenz:
- MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A11767