FGF2 Rabbit monoclonal antibody
Produktgrößen
5 ul
£ POA
A11488-5UL
20 ul
£164,00
A11488-20UL
100 ul
£342,00
A11488-100UL
500 ul
£1532,00
A11488-500UL
1000 ul
£2704,00
A11488-1000UL
Über dieses Produkt
- SKU:
- A11488
- Zusätzliche Namen:
- BFGF|F2|FGF-2|FGFB|HBGF-2
- Anwendung:
- ELISA, IHC-Paraffin, Western Blot
- Klonalität:
- Monoclonal
- Weitere Details:
- The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 18kDa/22kDa/31kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Sequenz:
- RAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A11488