TRADD Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A1145-20UL
100 ul
£336,00
A1145-100UL
500 ul
£1258,00
A1145-500UL
1000 ul
£2228,00
A1145-1000UL
Über dieses Produkt
- SKU:
- A1145
- Zusätzliche Namen:
- 9130005N23Rik|TRADD
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Predicted to enable death domain binding activity; identical protein binding activity; and signaling receptor binding activity. Involved in positive regulation of hair follicle development. Acts upstream of or within extrinsic apoptotic signaling pathway. Located in cytoplasm. Is expressed in adrenal gland; genitourinary system; liver; lung; and spleen. Orthologous to human TRADD (TNFRSF1A associated via death domain).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 36kda
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse
- Sequenz:
- AQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGLA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A1145