Ephrin B2 Rabbit monoclonal antibody
Produktgrößen
5 ul
£ POA
A11349-5UL
20 ul
£164,00
A11349-20UL
100 ul
£342,00
A11349-100UL
500 ul
£1532,00
A11349-500UL
1000 ul
£2704,00
A11349-1000UL
Über dieses Produkt
- SKU:
- A11349
- Zusätzliche Namen:
- Ephrin B2|ephrin-B2|EPLG5|Htk-L|HTKL|LERK5
- Anwendung:
- ELISA, IHC-Paraffin, Western Blot
- Klonalität:
- Monoclonal
- Weitere Details:
- This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNB class ephrin which binds to the EPHB4 and EPHA3 receptors.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 55kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- MAVRRDSVWKYCWGVLMVLCRTAISKSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLN
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A11349