Gsdma Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A10602-20UL
100 ul
£336,00
A10602-100UL
500 ul
£1258,00
A10602-500UL
1000 ul
£2228,00
A10602-1000UL
Über dieses Produkt
- SKU:
- A10602
- Zusätzliche Namen:
- Gsdm|Gsdm1|Gsdma|Gsdma1|H312E
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Predicted to enable phosphatidylinositol-4,5-bisphosphate binding activity; phosphatidylinositol-4-phosphate binding activity; and phosphatidylserine binding activity. Predicted to be involved in apoptotic process; defense response to bacterium; and pyroptosis. Predicted to act upstream of or within programmed cell death. Located in cytoplasm. Is expressed in esophagus epithelium; stomach; stomach cardiac region; stomach glandular region; and stomach glandular region mucosa. Orthologous to human GSDMA (gasdermin A).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 49kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Rat
- Sequenz:
- ASDVGEMHEDFKTLKEEVQRETQEVEKLSPVGRSSLLTSLSHLLGKKKELQDLEQTLEGALDKGHEVTLEALPKDVLLSKDAMDAILYFLGALTVLSEAQ
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A10602