ZSCAN4C Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A10205-20UL
100 ul
£336,00
A10205-100UL
500 ul
£1258,00
A10205-500UL
1000 ul
£2228,00
A10205-1000UL
Über dieses Produkt
- SKU:
- A10205
- Zusätzliche Namen:
- Gm397|XM_142517|ZSCAN4C|Zscan4d
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Acts upstream of or within negative regulation of mitotic recombination; regulation of transcription by RNA polymerase II; and telomere maintenance via telomere lengthening. Located in chromosome, telomeric region; cytoplasm; and nucleus. Is expressed in 1-cell stage embryo; 2-cell stage embryo; primary oocyte; and secondary oocyte. Orthologous to human ZSCAN4 (zinc finger and SCAN domain containing 4).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 57kda
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- CSRMFKHARSLSSHQRTHLNKKSELLCVTCQKMFKRVSDRRTHEIIHMPEKPFKCSTCEKSFSHKTNLKSHEMIHTGEMPYVCSLCSRRFRQSSTYHRHLRNYHRSD
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A10205