C/EBPB Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A0711-20UL
100 ul
£336,00
A0711-100UL
500 ul
£1258,00
A0711-500UL
1000 ul
£2228,00
A0711-1000UL
Über dieses Produkt
- SKU:
- A0711
- Zusätzliche Namen:
- C/EBP-beta|C/EBPB|IL6DBP|NF-IL6|TCF5
- Anwendung:
- ELISA, IHC-Paraffin, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain. The encoded protein functions as a homodimer but can also form heterodimers with CCAAT/enhancer-binding proteins alpha, delta, and gamma. Activity of this protein is important in the regulation of genes involved in immune and inflammatory responses, among other processes. The use of alternative in-frame AUG start codons results in multiple protein isoforms, each with distinct biological functions.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 48kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- AELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAV
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A0711