RhoA Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A0272-20UL
100 ul
£336,00
A0272-100UL
500 ul
£1258,00
A0272-500UL
1000 ul
£2228,00
A0272-1000UL
Über dieses Produkt
- SKU:
- A0272
- Zusätzliche Namen:
- ARH12|ARHA|EDFAOB|RHO12|RhoA|RHOH12
- Anwendung:
- ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants have been identified.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 22 kda
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- NIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A0272