FOXO3A Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A0102-20UL
100 ul
£336,00
A0102-100UL
500 ul
£1258,00
A0102-500UL
1000 ul
£2228,00
A0102-1000UL
Über dieses Produkt
- SKU:
- A0102
- Zusätzliche Namen:
- 1110048B16Rik|2010203A17Rik|Fkhr2|FKHRL1|Foxo3a
- Anwendung:
- ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Enables DNA binding activity; DNA-binding transcription factor activity, RNA polymerase II-specific; and mitochondrial transcription factor activity. Involved in several processes, including mitochondrial transcription; positive regulation of muscle atrophy; and positive regulation of pri-miRNA transcription by RNA polymerase II. Acts upstream of or within several processes, including extrinsic apoptotic signaling pathway in absence of ligand; female gonad development; and neuronal stem cell population maintenance. Located in cytosol; mitochondrial outer membrane; and nucleus. Part of protein-containing complex. Colocalizes with mitochondrial matrix. Is expressed in several structures, including alimentary system; brain; early embryo; genitourinary system; and hemolymphoid system. Used to study dermoid cyst of ovary. Orthologous to human FOXO3 (forkhead box O3).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 80-90 kda
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- LSDSSSLGSAKHQQQSPASQSMQTLSDSLSGSSLYSASANLPVMGHDKFPSDLDLDMFNGSLECDMESIIRSELMDAD
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A0102