tatM2NX
Produktgrößen
1 mg
TP-010-1MG
Über dieses Produkt
- SKU:
- TP-010
- Zusätzliche Namen:
- tatM2NX, YGRKKRRQRRRGSREPGEMLPRKLKRVLRQEFWV, TP-010, TP010
- Weitere Details:
- tatM2NX is a peptide generated by fusing part of the C-terminus of transient receptor potential melastin 2 (TRPM2) channels, corresponding more than 90% with the Nudix domain (M2NX), with the tat inducer of HIV. tatM2NX is a TRPM2 antagonist which prevents ligand binding and TRPM2 activation, and inhibits over 90% of human TRPM2 channel currents at concentrations as low as 2 uM. tatM2NX is an antagonist with an IC50 of 396 nM and is neuroprotective in animal models of focal and global ischemia.
- Immunogen:
- Transient receptor potential (TRP) channels
- Molekulargewicht:
- 4354.17
- Physischer Zustand:
- Freeze dried solid
- Reinheit:
- >95%
- Referenzen:
- <p>Shimizu et al (2016) Extended therapeutic window of a novel peptide inhibitor of TRPM2 channels following focal cerebral ischemia. Exp Neurol. 283(Pt A) 151 <a href="https://pubmed.ncbi.nlm.nih.gov/27317297/" target="_blank">PMID: 27317297</a><br></p><p>Cruz-Torres et al (2020) Characterization and Optimization of the Novel Transient Receptor Potential Melastatin 2 Antagonist tatM2NX. Mol Pharmacol. <strong>97</strong>(2) 102 <a href="https://pubmed.ncbi.nlm.nih.gov/31772034/" target="_blank">PMID: 31772034</a></p>
- Sequenz:
- H-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Ser-Arg-Glu-Pro-Gly-Glu-Met-Leu-Pro-Arg-Lys-Leu-Lys-Arg-Val-Leu-Arg-Gln-Glu-Phe-Trp-Val-OH
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- Store dry, frozen and in the dark
- Größe:
- 1 mg
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble in water
- Formula:
- C190H323N71O45 S