Alpha Synuclein Pre-formed Fibrils: ATTO 594 (Type 1) Product Size(s) 100 ug £627.00 SPR-322B-A594 Add to order Added to order Academic Pricing Please contact us for academic pricing. Contact Us About this Product SKU: SPR-322B-A594 Additional Names: Active Alpha synuclein PFFs, Active Alpha synuclein aggregates, Alpha synuclein PFF, Active Alpha synuclein protein aggregates, Active Alpha synuclein aggregates, Active Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkinson's disease familial 1 Protein, Active Alpha synuclein protein seed, ATTO 594 conjugated alpha synuclein, ATTO labelled alpha synuclein fibrils Application: Cell-based/Functional Assay, SDS-PAGE, Western Blot CE/IVD: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only. Conjugate: ATTO 594 Extra Details: Alpha-Synuclein (SNCA) is expressed predominantly in the brain, where it is concentrated in presynaptic nerve terminals (1). Alpha-synuclein is highly expressed in the mitochondria of the olfactory bulb, hippocampus, striatum and thalamus (2). Functionally, it has been shown to significantly interact with tubulin (3), and may serve as a potential microtubule-associated protein. It has also been found to be essential for normal development of the cognitive functions; inactivation may lead to impaired spatial learning and working memory (4). SNCA fibrillar aggregates represent the major non A-beta component of Alzheimers disease amyloid plaque, and a major component of Lewy body inclusions, and Parkinson's disease. Parkinson's disease (PD) is a common neurodegenerative disorder characterized by the progressive accumulation in selected neurons of protein inclusions containing alpha-synuclein and ubiquitin (5, 6). Gene Details: SNCA Protein Details: P37840 Purity: >95% Purification: Ion Exchange Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAG Shipping Conditions: Dry Ice Storage Conditions: -70[o]C Supplier: StressMarq Biosciences Type: Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins Size: 100 ug Manufacturer's Data Sheet: Accession: NP_000336.1 Need Help?