Skip to content

Basket

You currently have no items in your basket.

HSP65 Protein

SKU:
SPR-116B
Academic Pricing:
Please contact us at info@2bscientific.com for specific academic pricing
Additional Names:
60kDa chaperonin 2 Protein, Antigen A Protein, Cell wall protein A Protein, groEL Protein, GroEL2 Protein, GroL2 Protein, M. Tuberculosis cell wall protein A Protein, M. Tuberculosis HSP65 Protein, Protein Cpm60 2 Protein
Application:
Western Blot, Functional Assay, ELISA, SDS-PAGE
Buffer:
10mM Tris pH8, 105 mM NaCl, 5 mM EDTA
Conjugate:
No tag
Concentration:
Lot/batch specific. See included datasheet.
Protein Details:
AAQ64501.1
Purity:
>90%
Purification:
Multi-Step Purified
References:
28115505|27742830|17920518|26925118|25463133|24066722
Research Area:
Cancer, Heat Shock
Sequence:
EDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLRNVAAGANPLGLKRGIEKAVEKVTETLLKGAKEVETKEQIAATAAISAGDQSIGDLIAEAMDKVGNEGVITVEESNTFGLQLELTEGMRFDKGYISGYFVTDPERQEAVLEDPYILLVSSKVSTVKDLLPLXXXXXXXGKPLLIIAEDVEGEALSTLV
Shipping Conditions:
Blue Ice
Storage Conditions:
-20oC
Supplier:
StressMarq Biosciences Inc
Size:
100 µg
  • Download:
Price for 100 µg £379.00

We use cookies to give you the best experience of using this website. By continuing to use this site, you accept our use of cookies. Please read our Cookie Policy for more information.