Skip to content

Basket

You currently have no items in your basket.

Mycobacterium bovis BCG Recombinant HSP65 Partial Protein

SKU:
SPR-116A
Academic Pricing:
Please contact us at info@2bscientific.com for specific academic pricing
Additional Names:
60kDa chaperonin 2 Protein, Antigen A Protein, Cell wall protein A Protein, groEL Protein, GroEL2 Protein, GroL2 Protein, M. Tuberculosis cell wall protein A Protein, M. Tuberculosis HSP65 Protein, Protein Cpm60 2 Protein
Application:
Western Blot, Electrophoresis, Functional Assay, ELISA
Buffer:
10mM Tris pH8, 105 mM NaCl, 5 mM EDTA
Conjugate:
No tag
Format:
Partial
Host:
E. Coli
Molecular Weight:
~65 kDa
Protein Details:
AAQ64501.1
Purity:
>90%
Purification:
Multi-Step Purified
References:
1. Koll H., et al. (1992) Cell. 68: 1163-1175. 2. Thole J.E.R., et al. (1985) Infect. Immuno. 50: 800-806. 3. Thole J.E.R., et al., (1987) Infect. Immuno. 55: 1466-1475. 4. Shinnick T.M. Sweetser D., Thole J., van Embden J. and Young R.A. (1987) Infect. Immuno. 55: 1932-1935. 5. Van Eden W., et al. (1988) Nature 331: 171-178. 6. Cobelens P.M., et al. (2002) Rheumatology 41: 775-779.
Sequence:
EDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLRNVAAGANPLGLKRGIEKAVEKVTETLLKGAKEVETKEQIAATAAISAGDQSIGDLIAEAMDKVGNEGVITVEESNTFGLQLELTEGMRFDKGYISGYFVTDPERQEAVLEDPYILLVSSKVSTVKDLLPLXXXXXXXGKPLLIIAEDVEGEALSTLV
Shipping Conditions:
Blue Ice
Source:
Mycobacterium bovis BCG
Storage Conditions:
-20[o}C
Supplier:
StressMarq Biosciences Inc
Size:
50 ug
  • Manufacturer's Data Sheet:
Price for 50 ug £277.00

We use cookies to give you the best experience of using this website. By continuing to use this site, you accept our use of cookies. Please read our Cookie Policy for more information.