Skip to content

Basket

You currently have no items in your basket.

Proteins and Peptides

Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9(nsp9)

Product Size(s)
500 ug
£3440.00
CSB-MP3388GND-500UG
Academic Pricing
Please contact us for academic pricing.
Contact Us
About this Product
SKU:
CSB-MP3388GND-500UG
Molecular Weight:
44.5 kDa
Purity:
>90%
Sequence:
NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELE PPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Shipping Conditions:
Blue Ice
Storage Conditions:
Please refer to datasheet
Supplier:
Cusabio
Type:
Proteins, Peptides, Small Molecoles & Other Biomolecules: Recombinant Proteins
Size:
500 ug
Epitope Tag:
hFc-FLAG™ Tag