Skip to content

Basket

You currently have no items in your basket.

Proteins and Peptides

Recombinant Chikungunya virus Non-structural protein 4(nsP4),partial

Product Size(s)
1 mg
£2595.00
CSB-EP810351CJAT-1MG
Academic Pricing
Please contact us for academic pricing.
Contact Us
About this Product
SKU:
CSB-EP810351CJAT-1MG
Additional Names:
Polyprotein nsP1234
Molecular Weight:
31.1 kDa
Purity:
>85%
Sequence:
DTVLETDIASFDKSQDDSLALTALMLLEDLGVDHSLLDLIEAAFGEISSCHLPTGTRFKFGAMMKSGMFLTLFVNTLLNITIASRVLEDRLTKSACAAFIGDDNIIHGVVSDELMAARCATWMNMEVKIIDAVVSQKAPYFCGGFILHDIVTGTACRVADPLKRLFKLGKPLAAGDEQDEDRRRALADEVVRWQRTGLIDELEKAVYSRYEVQGISVVVMSMATFASSRSNFEKLRGPVVTLYGGPK
Shipping Conditions:
Blue Ice
Storage Conditions:
-20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:
Cusabio
Type:
Proteins, Peptides, Small Molecoles & Other Biomolecules: Recombinant Proteins
Size:
1 mg
Epitope Tag:
6xHIS Tag
Uniprot:
Q8JUX6
Synonyms:
Polyprotein nsP1234