Skip to content

Basket

You currently have no items in your basket.

Recombinant Escherichia coli Peptidyl-prolyl cis-trans isomerase A(ppiA)

SKU:
CSB-EP360284EOD-100UG
Additional Names:
PPIase A Alternative name(s): Cyclophilin A Rotamase A
Molecular Weight:
34.1 kDa
Purity:
>90%
Sequence:
AKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKPVVILSAKVLP
Shipping Conditions:
Blue Ice
Storage Conditions:
-20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:
Cusabio
Type:
Proteins, Peptides, Small Molecoles & Other Biomolecules: Recombinant Proteins
Size:
100 ug
Epitope Tag:
6xHIS-SUMO Tag
Uniprot:
P0AFL5
Synonyms:
Cyclophilin A;Rotamase A
Price for 100 ug £892.00

Academic Pricing

Please contact us for academic pricing.

Contact Us