Skip to content

Basket

You currently have no items in your basket.

Recombinant Human Peptidyl-prolyl cis-trans isomerase A(PPIA)

SKU:
CSB-EP351810HU1-20UG
Additional Names:
Cyclophilin ACyclosporin A-binding proteinRotamase A
Molecular Weight:
44.9 kDa
Purity:
>90%
Sequence:
VNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
Shipping Conditions:
Blue Ice
Storage Conditions:
-20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:
Cusabio
Type:
Proteins, Peptides, Small Molecoles & Other Biomolecules: Recombinant Proteins
Size:
20 ug
Epitope Tag:
GST Tag
Uniprot:
P62937
Synonyms:
Cyclophilin A;Cyclosporin A-binding protein;Rotamase A
Price for 20 ug £397.00

Academic Pricing

Please contact us for academic pricing.

Contact Us