Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9(nsp9) Product Size(s) 20 ug £397.00 CSB-EP3388GND-20UG Add to order Added to order Academic Pricing Please contact us for academic pricing. Contact Us About this Product SKU: CSB-EP3388GND-20UG Molecular Weight: 13.9 kDa Purity: >90% Sequence: NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELE PPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ Shipping Conditions: Blue Ice Storage Conditions: Please refer to datasheet Supplier: Cusabio Type: Proteins, Peptides, Small Molecoles & Other Biomolecules: Recombinant Proteins Size: 20 ug Manufacturer's Data Sheet:Recombinant-Severe-acute-respiratory-syndrome-coronavirus-2-Non-structural-protein-9-nsp9--12928627.html Epitope Tag: 10xHIS Tag (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Predicted band size: 13.9 kDa Observed band size: 15 kDa due to molecular structure of protein Need Help?