Skip to content

Basket

You currently have no items in your basket.

Proteins and Peptides

Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9(nsp9)

Product Size(s)
20 ug
£397.00
CSB-EP3388GND-20UG
Academic Pricing
Please contact us for academic pricing.
Contact Us
About this Product
SKU:
CSB-EP3388GND-20UG
Molecular Weight:
13.9 kDa
Purity:
>90%
Sequence:
NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELE PPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Shipping Conditions:
Blue Ice
Storage Conditions:
Please refer to datasheet
Supplier:
Cusabio
Type:
Proteins, Peptides, Small Molecoles & Other Biomolecules: Recombinant Proteins
Size:
20 ug
Epitope Tag:
10xHIS Tag