Skip to content

Basket

You currently have no items in your basket.

Recombinant Human NK-tumor recognition protein(NKTR),partial

SKU:
CSB-EP015838HU-20UG
Additional Names:
Natural-killer cells cyclophilin-related protein 1 domains:Putative peptidyl-prolyl cis-trans isomerase (EC:5.2.1.8) ;PPIase ;Rotamase
Molecular Weight:
34.4 kDa
Purity:
>90%
Sequence:
HFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV
Shipping Conditions:
Blue Ice
Storage Conditions:
-20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:
Cusabio
Type:
Proteins, Peptides, Small Molecoles & Other Biomolecules: Recombinant Proteins
Size:
20 ug
Epitope Tag:
6xHIS-SUMO Tag
Uniprot:
P30414
Synonyms:
Natural-killer cells cyclophilin-related protein;Peptidyl-prolyl cis-trans isomerase NKTR;Rotamase
Price for 20 ug £397.00

Academic Pricing

Please contact us for academic pricing.

Contact Us