Skip to content

Basket

You currently have no items in your basket.

Recombinant Mycobacterium tuberculosis Antigen 85-A(fbpA),partial

SKU:
CSB-RP182794Ba
Academic Pricing:
Please contact us at info@2bscientific.com for specific academic pricing
Additional Names:
Acyl-CoA:diacylglycerol acyltransferase Antigen 85 complex A Short name: 85A Short name: Ag85A Fibronectin-binding protein A Short name: Fbps A
Application:
WB, SDS-PAGE
Extra Details:
Large sizes are available.
Host:
E.coli
Molecular Weight:
34.1 kDa
Protein Details:
Tag information:N-terminal 6xHis-tagged
Purity:
Greater than 90% as determined by SDS-PAGE.
Sequence:
YLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLNAMKPDLQRALGATPNT
Shipping Conditions:
Blue Ice
Source:
Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Storage Conditions:
Please refer to datasheet
Supplier:
Cusabio-Flarebio
Size:
10ug
  • Download:
Price for 10ug £433.00

We use cookies to give you the best experience of using this website. By continuing to use this site, you accept our use of cookies. Please read our Cookie Policy for more information.